General Information

  • ID:  hor004328
  • Uniprot ID:  A0A3B3IP44
  • Protein name:  Substance P
  • Gene name:  tac1
  • Organism:  Oryzias latipes (Japanese rice fish) (Japanese killifish)
  • Family:  Tachykinin family
  • Source:  animal
  • Expression:  Brain
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oryzias (genus), Oryziinae (subfamily), Adrianichthyidae (family), Adrianichthyoidei (suborder), Beloniformes (order), Atherinomorphae (superorder), Ovalentaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007217 tachykinin receptor signaling pathway
  • GO CC:  NA

Sequence Information

  • Sequence:  KPRPHQFIGLM
  • Length:  11
  • Propeptide:  MKLLLLLSALVALLTGVRVLCQDPEPKEDADYWTSTNHQDGWLSSEPLREMLLRMTRKPRPHQFIGLMGRRSTGEGCSICVCVCVWMSRSHSMSLFAPTSTLPLPPSSKRTDHQEK
  • Signal peptide:  MKLLLLLSALVALLTGVRVLC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May be involved in modulating medaka behaviors
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A3B3IP44-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004328_AF2.pdbhor004328_ESM.pdb

Physical Information

Mass: 150217 Formula: C61H98N18O13S
Absent amino acids: ACDENSTVWY Common amino acids: P
pI: 11.65 Basic residues: 3
Polar residues: 1 Hydrophobic residues: 3
Hydrophobicity: -51.82 Boman Index: -1456
Half-Life: 1.3 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 70.91
Instability Index: 603.64 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  19118555
  • Title:  Mass Spectrometric Map of Neuropeptide Expression and Analysis of the Gamma-Prepro-Tachykinin Gene Expression in the Medaka (Oryzias Latipes) Brain